PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_002533-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 236aa    MW: 26514.7 Da    PI: 7.7123
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_002533-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding285.3e-092366344
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                     +WT   d+l+ +a   ++ g   +W +Ia  ++ g+t+ ++++++
    NNU_002533-RA 23 PWTRVQDKLFERALVTFPEGtldRWQKIAGQVP-GKTALEVRDHY 66
                     8********************************.**********9 PP

2Myb_DNA-binding43.47.8e-14123167347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + +++G+g+W++I+r     Rt+ q+ s+ qky
    NNU_002533-RA 123 PWTEEEHRLFLIGLQKYGKGDWRSISRNAVVSRTPTQVASHAQKY 167
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.7371670IPR017877Myb-like domain
SMARTSM007174.6E-82072IPR001005SANT/Myb domain
SuperFamilySSF466898.22E-122277IPR009057Homeodomain-like
PfamPF002492.1E-72367IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-42367IPR009057Homeodomain-like
CDDcd001672.63E-72470No hitNo description
PROSITE profilePS5129419.296116172IPR017930Myb domain
SuperFamilySSF466894.79E-17117173IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-17119170IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.7E-12120166IPR009057Homeodomain-like
SMARTSM007173.0E-10120170IPR001005SANT/Myb domain
PfamPF002491.8E-11123167IPR001005SANT/Myb domain
CDDcd001674.09E-10123167No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MFQENLWMMG GNFSPSPSPF PSPWTRVQDK LFERALVTFP EGTLDRWQKI AGQVPGKTAL  60
EVRDHYEALV HDVQEIDSGR VEVPDYADNS FTPSWASECQ ASQISFGSKP PRQTETERKK  120
GVPWTEEEHR LFLIGLQKYG KGDWRSISRN AVVSRTPTQV ASHAQKYYLR LNSVKKEKKR  180
SSIHDITTVD TNPVNVGPNP PSSGPTQMVE TIDPTNPYPV SSTAPIQGYQ GFGFSM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-1423861073RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010245815.11e-177PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H75e-58DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLQ8S8Z92e-89Q8S8Z9_SOYBN; Syringolide-induced protein 1-3-1B
STRINGGLYMA20G24600.15e-89(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.13e-76MYB family protein